PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004487498.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 409aa    MW: 46267.5 Da    PI: 8.6317
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004487498.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.9e-3348102155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kprl+Wtp+LH+rF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  XP_004487498.1  48 KPRLKWTPDLHARFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 102
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.48945105IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-3146103IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1647103IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-2348103IPR006447Myb domain, plants
PfamPF002492.4E-950101IPR001005SANT/Myb domain
PfamPF143791.2E-24155202IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MYHQHHHQHQ GKNIHSSSRM SIPSERHMFL QTGNGSSDSG LVLSTDAKPR LKWTPDLHAR  60
FIEAVNQLGG ADKATPKTVM KLMGIPGLTL YHLKSHLQKY RLSKNLHGQS NNNNVTHKIN  120
THATSGTDER SLSETNGTHM NKLITLGPQT NNKDIHISEA LQMQIEVQRR LNEQLEVQRH  180
LQLRIEAQGK YLQSVLEKAQ ETLGRQNLGI VGLEAAKVQL SELVSKVSSQ SLNSAFSEMK  240
ELQGFNNPQQ QTQITTNQPN DCSMDSSCLT SSDRSQKEQQ EIIQNGGGFG LRHFNNNNNH  300
LFMERKELQQ VTETNIRNSE VLKWCSDEVK KNTSTNFHGN LSMSIGVESH SDGEFQRTSR  360
TDQTMKLAMD DHKMQPSNSY FSTSRLDLNS RGDNNEGCKQ LDLNRFSWN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1469490.0BT146949.1 Medicago truncatula clone JCVI-FLMt-19I1 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004487498.10.0PREDICTED: uncharacterized protein LOC101506129 isoform X3
TrEMBLG7ITS90.0G7ITS9_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA12G31020.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-122G2-like family protein